NONO (NM_007363) Human Recombinant Protein
CAT#: TP306688
Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 2, 20 µg
View other "NONO" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206688 protein sequence
Red=Cloning site Green=Tags(s) MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031389 |
Locus ID | 4841 |
UniProt ID | Q15233, A0A0S2Z4Z9 |
Refseq Size | 3114 |
Cytogenetics | Xq13.1 |
Refseq ORF | 1413 |
Synonyms | MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114 |
Summary | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
G-quadruplexes offer a conserved structural motif for NONO recruitment to NEAT1 architectural lncRNA
,null,
Nucleic Acids Research
,PubMed ID 32496517
[NONO]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402135 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428867 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428868 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428869 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402135 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 2 |
CNY 3,080.00 |
|
LY428867 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 1 |
CNY 3,080.00 |
|
LY428868 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 3 |
CNY 3,080.00 |
|
LY428869 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 4 |
CNY 3,080.00 |
|
PH306688 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_031389) |
CNY 19,520.00 |
|
PH326567 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138880) |
CNY 19,520.00 |
|
PH326579 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881) |
CNY 19,520.00 |
|
TP326567 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326579 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 3, 20 µg |
CNY 2,900.00 |