United States
Germany
Japan
United Kingdom
China
NONO (NM_001145409) Human Mass Spec Standard
CAT＃: PH326579
NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881)
View other "NONO" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226579 |
| Predicted MW | 54.2 kDa |
| Protein Sequence |
>RC226579 protein sequence
Red=Cloning site Green=Tags(s) MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138881 |
| RefSeq Size | 3057 |
| RefSeq ORF | 1413 |
| Synonyms | MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114 |
| Locus ID | 4841 |
| Cytogenetics | Xq13.1 |
| Summary | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402135 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428867 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428868 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428869 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402135 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 2 |
CNY 3,080.00 |
|
| LY428867 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 1 |
CNY 3,080.00 |
|
| LY428868 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 3 |
CNY 3,080.00 |
|
| LY428869 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 4 |
CNY 3,080.00 |
|
| PH306688 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_031389) |
CNY 19,520.00 |
|
| PH326567 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138880) |
CNY 19,520.00 |
|
| TP306688 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326567 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326579 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 3, 20 µg |
CNY 2,900.00 |
