NONO (NM_001145409) Human Mass Spec Standard
CAT#: PH326579
NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881)
View other "NONO" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226579 |
Predicted MW | 54.2 kDa |
Protein Sequence |
>RC226579 protein sequence
Red=Cloning site Green=Tags(s) MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001138881 |
RefSeq Size | 3057 |
RefSeq ORF | 1413 |
Synonyms | MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114 |
Locus ID | 4841 |
Cytogenetics | Xq13.1 |
Summary | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402135 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428867 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428868 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428869 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402135 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 2 |
CNY 3,080.00 |
|
LY428867 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 1 |
CNY 3,080.00 |
|
LY428868 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 3 |
CNY 3,080.00 |
|
LY428869 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 4 |
CNY 3,080.00 |
|
PH306688 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_031389) |
CNY 19,520.00 |
|
PH326567 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138880) |
CNY 19,520.00 |
|
TP306688 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP326567 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326579 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 3, 20 µg |
CNY 2,900.00 |