ARH (LDLRAP1) (NM_015627) Human Recombinant Protein
CAT#: TP306643
Recombinant protein of human low density lipoprotein receptor adaptor protein 1 (LDLRAP1), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206643 representing NM_015627
Red=Cloning site Green=Tags(s) MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAA IKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQS LECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATG NLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQD MHYAQCLSPVDWDKPDSSGTEQDDLFSF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056442 |
Locus ID | 26119 |
UniProt ID | Q5SW96, B3KR97 |
Refseq Size | 2862 |
Cytogenetics | 1p36.11 |
Refseq ORF | 924 |
Synonyms | ARH; ARH1; ARH2; FHCB1; FHCB2; FHCL4 |
Summary | The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414462 | LDLRAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414462 | Transient overexpression lysate of low density lipoprotein receptor adaptor protein 1 (LDLRAP1) |
CNY 3,080.00 |
|
PH306643 | LDLRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056442) |
CNY 19,520.00 |