DR1 (NM_001938) Human Recombinant Protein
CAT#: TP305733
Recombinant protein of human down-regulator of transcription 1, TBP-binding (negative cofactor 2) (DR1), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205733 protein sequence
Red=Cloning site Green=Tags(s) MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEH VIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQE WLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001929 |
Locus ID | 1810 |
UniProt ID | Q01658 |
Refseq Size | 3222 |
Cytogenetics | 1p22.1 |
Refseq ORF | 528 |
Synonyms | NC2; NC2-BETA; NC2B; NCB2 |
Summary | This gene encodes a TBP- (TATA box-binding protein) associated phosphoprotein that represses both basal and activated levels of transcription. The encoded protein is phosphorylated in vivo and this phosphorylation affects its interaction with TBP. This protein contains a histone fold motif at the amino terminus, a TBP-binding domain, and a glutamine- and alanine-rich region. The binding of DR1 repressor complexes to TBP-promoter complexes may establish a mechanism in which an altered DNA conformation, together with the formation of higher order complexes, inhibits the assembly of the preinitiation complex and controls the rate of RNA polymerase II transcription. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419640 | DR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419640 | Transient overexpression lysate of down-regulator of transcription 1, TBP-binding (negative cofactor 2) (DR1) |
CNY 3,080.00 |
|
PH305733 | DR1 MS Standard C13 and N15-labeled recombinant protein (NP_001929) |
CNY 19,520.00 |