HAO2 (NM_016527) Human Recombinant Protein
CAT#: TP305051
Recombinant protein of human hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1, 20 µg
View other "HAO2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205051 protein sequence
Red=Cloning site Green=Tags(s) MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR L myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057611 |
Locus ID | 51179 |
UniProt ID | Q9NYQ3 |
Refseq Size | 1488 |
Cytogenetics | 1p12 |
Refseq ORF | 1053 |
Synonyms | GIG16; HAOX2 |
Summary | This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413922 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC423655 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY413922 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY423655 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 |
CN¥ 3,080.00 |
|
PH305051 | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611) |
CN¥ 19,520.00 |
|
PH318416 | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783) |
CN¥ 14,250.00 |
|
TP318416 | Purified recombinant protein of Homo sapiens hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2, 20 µg |
CN¥ 2,900.00 |