HAO2 (NM_016527) Human Mass Spec Standard
CAT#: PH305051
HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611)
View other "HAO2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205051 |
Predicted MW | 38.8 kDa |
Protein Sequence |
>RC205051 protein sequence
Red=Cloning site Green=Tags(s) MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR L myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057611 |
RefSeq Size | 1488 |
RefSeq ORF | 1053 |
Synonyms | GIG16; HAOX2 |
Locus ID | 51179 |
Cytogenetics | 1p12 |
Summary | This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413922 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423655 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413922 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1 |
CNY 3,080.00 |
|
LY423655 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 |
CNY 3,080.00 |
|
PH318416 | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783) |
CNY 14,250.00 |
|
TP305051 | Recombinant protein of human hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP318416 | Purified recombinant protein of Homo sapiens hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2, 20 µg |
CNY 2,900.00 |