VPREB3 (NM_013378) Human Recombinant Protein
CAT#: TP304662
Recombinant protein of human pre-B lymphocyte 3 (VPREB3), 20 µg
View other "VPREB3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204662 protein sequence
Red=Cloning site Green=Tags(s) MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLY YRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037510 |
Locus ID | 29802 |
UniProt ID | Q9UKI3 |
Refseq Size | 602 |
Cytogenetics | 22q11 |
Refseq ORF | 369 |
Synonyms | 8HS20; N27C7-2 |
Summary | The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415623 | VPREB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415623 | Transient overexpression lysate of pre-B lymphocyte 3 (VPREB3) |
CNY 3,080.00 |
|
PH304662 | VPREB3 MS Standard C13 and N15-labeled recombinant protein (NP_037510) |
CNY 19,520.00 |