VPREB3 (NM_013378) Human Mass Spec Standard
CAT#: PH304662
VPREB3 MS Standard C13 and N15-labeled recombinant protein (NP_037510)
View other "VPREB3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | VPREB3 MS Standard C13 and N15-labeled recombinant protein (NP_037510) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204662 |
Predicted MW | 13.7 kDa |
Protein Sequence |
>RC204662 protein sequence
Red=Cloning site Green=Tags(s) MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLY YRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037510 |
RefSeq Size | 602 |
RefSeq ORF | 369 |
Synonyms | 8HS20; N27C7-2 |
Locus ID | 29802 |
Cytogenetics | 22q11 |
Summary | The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415623 | VPREB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415623 | Transient overexpression lysate of pre-B lymphocyte 3 (VPREB3) |
CNY 3,080.00 |
|
TP304662 | Recombinant protein of human pre-B lymphocyte 3 (VPREB3), 20 µg |
CNY 2,900.00 |