HDHD1A (PUDP) (NM_012080) Human Recombinant Protein
CAT#: TP304419
Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2, 20 µg
View other "HDHD1A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204419 protein sequence
Red=Cloning site Green=Tags(s) MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDI FLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGL PSYE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036212 |
Locus ID | 8226 |
UniProt ID | Q08623 |
Refseq Size | 2155 |
Cytogenetics | Xp22.31 |
Refseq ORF | 642 |
Synonyms | DXF68S1E; FAM16AX; GS1; HDHD1; HDHD1A |
Summary | This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415984 | HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432645 | HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415984 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2 |
CNY 3,080.00 |
|
LY432645 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1 (HDHD1), transcript variant 4 |
CNY 3,080.00 |
|
PH304419 | HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212) |
CNY 19,520.00 |