FAIM1 (FAIM) (NM_001033032) Human Recombinant Protein
CAT#: TP304411
Recombinant protein of human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3, 20 µg
View other "FAIM1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204411 protein sequence
Red=Cloning site Green=Tags(s) MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028204 |
Locus ID | 55179 |
UniProt ID | Q9NVQ4 |
Refseq Size | 1104 |
Cytogenetics | 3q22.3 |
Refseq ORF | 537 |
Synonyms | FAIM1 |
Summary | The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413277 | FAIM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422347 | FAIM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413277 | Transient overexpression lysate of Fas apoptotic inhibitory molecule (FAIM), transcript variant 4 |
CNY 3,080.00 |
|
LY422347 | Transient overexpression lysate of Fas apoptotic inhibitory molecule (FAIM), transcript variant 3 |
CNY 3,080.00 |
|
PH304411 | FAIM MS Standard C13 and N15-labeled recombinant protein (NP_001028204) |
CNY 19,520.00 |
|
TP762644 | Purified recombinant protein of Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 4 |
CNY 2,480.00 |