FAIM1 (FAIM) (NM_001033032) Human Mass Spec Standard
CAT#: PH304411
FAIM MS Standard C13 and N15-labeled recombinant protein (NP_001028204)
View other "FAIM1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FAIM MS Standard C13 and N15-labeled recombinant protein (NP_001028204) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204411 |
Predicted MW | 20.2 kDa |
Protein Sequence |
>RC204411 protein sequence
Red=Cloning site Green=Tags(s) MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001028204 |
RefSeq Size | 1104 |
RefSeq ORF | 537 |
Synonyms | FAIM1 |
Locus ID | 55179 |
Cytogenetics | 3q22.3 |
Summary | The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413277 | FAIM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422347 | FAIM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413277 | Transient overexpression lysate of Fas apoptotic inhibitory molecule (FAIM), transcript variant 4 |
CNY 3,080.00 |
|
LY422347 | Transient overexpression lysate of Fas apoptotic inhibitory molecule (FAIM), transcript variant 3 |
CNY 3,080.00 |
|
TP304411 | Recombinant protein of human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP762644 | Purified recombinant protein of Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 4 |
CNY 2,480.00 |