CTHRC1 (NM_138455) Human Recombinant Protein
CAT#: TP304348
Recombinant protein of human collagen triple helix repeat containing 1 (CTHRC1), 20 µg
View other "CTHRC1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204348 protein sequence
Red=Cloning site Green=Tags(s) MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPG ANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVL FSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVD VAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612464 |
Locus ID | 115908 |
UniProt ID | Q96CG8 |
Refseq Size | 1279 |
Cytogenetics | 8q22.3 |
Refseq ORF | 729 |
Summary | This locus encodes a protein that may play a role in the cellular response to arterial injury through involvement in vascular remodeling. Mutations at this locus have been associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408605 | CTHRC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408605 | Transient overexpression lysate of collagen triple helix repeat containing 1 (CTHRC1) |
CNY 3,080.00 |
|
PH304348 | CTHRC1 MS Standard C13 and N15-labeled recombinant protein (NP_612464) |
CNY 19,520.00 |