DHRS1 (NM_138452) Human Recombinant Protein
CAT#: TP304206
Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2, 20 µg
View other "DHRS1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204206 protein sequence
Red=Cloning site Green=Tags(s) MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP AGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612461 |
Locus ID | 115817 |
UniProt ID | Q96LJ7 |
Refseq Size | 1488 |
Cytogenetics | 14q12 |
Refseq ORF | 939 |
Synonyms | SDR19C1 |
Summary | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408602 | DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427794 | DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408602 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2 |
CNY 3,080.00 |
|
LY427794 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1 |
CNY 3,080.00 |
|
PH304206 | DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461) |
CNY 19,520.00 |
|
PH327656 | DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_001129522) |
CNY 19,520.00 |
|
TP327656 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1, 20 µg |
CNY 2,900.00 |