DHRS1 (NM_138452) Human Mass Spec Standard
CAT#: PH304206
DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461)
View other "DHRS1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204206 |
Predicted MW | 33.9 kDa |
Protein Sequence |
>RC204206 protein sequence
Red=Cloning site Green=Tags(s) MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP AGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612461 |
RefSeq Size | 1488 |
RefSeq ORF | 939 |
Synonyms | SDR19C1 |
Locus ID | 115817 |
Cytogenetics | 14q12 |
Summary | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408602 | DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427794 | DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408602 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2 |
CNY 3,080.00 |
|
LY427794 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1 |
CNY 3,080.00 |
|
PH327656 | DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_001129522) |
CNY 19,520.00 |
|
TP304206 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327656 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1, 20 µg |
CNY 2,900.00 |