alpha Tubulin (TUBA3C) (NM_079836) Human Recombinant Protein
CAT#: TP304072
Recombinant protein of human tubulin, alpha 3c (TUBA3C), transcript variant 2, 20 µg
View other "alpha Tubulin" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204072 protein sequence
Red=Cloning site Green=Tags(s) MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL EPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHS FGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDLAALEKDYEEVGVDSVEAEAEEGEEY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 29427009) |
Reference Data | |
RefSeq | NP_524575 |
Locus ID | 7278 |
UniProt ID | Q13748 |
Refseq Size | 1408 |
Cytogenetics | 13q12.11 |
Refseq ORF | 1254 |
Synonyms | bA408E5.3; TUBA2; tubulin, alpha 2; tubulin, alpha 3c |
Summary | Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Gap junction, Pathogenic Escherichia coli infection |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Anti-tubulin-α-1C autoantibody in systemic lupus erythematosus: a novel indicator of disease activity and vasculitis manifestations
,Zhao, X;Cheng, Y;Gan, Y;Jia, R;Zhu, L;Sun, X;,
Clin. Rheumatol.
,PubMed ID 29427009
[TUBA3C]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409205 | TUBA3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416933 | TUBA3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY409205 | Transient overexpression lysate of tubulin, alpha 3c (TUBA3C), transcript variant 2 |
CNY 3,080.00 |
|
LY416933 | Transient overexpression lysate of tubulin, alpha 3c (TUBA3C) |
CNY 4,840.00 |
|
PH304072 | TUBA3C MS Standard C13 and N15-labeled recombinant protein (NP_524575) |
CNY 19,520.00 |
其它alpha Tubulin产品