PGAM1 (NM_002629) Human Recombinant Protein
CAT#: TP304054
Recombinant protein of human phosphoglycerate mutase 1 (brain) (PGAM1), 20 µg
View other "PGAM1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204054 protein sequence
Red=Cloning site Green=Tags(s) MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002620 |
Locus ID | 5223 |
UniProt ID | P18669 |
Refseq Size | 1762 |
Cytogenetics | 10q24.1 |
Refseq ORF | 762 |
Synonyms | HEL-S-35; PGAM-B; PGAMA |
Summary | The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400934 | PGAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400934 | Transient overexpression lysate of phosphoglycerate mutase 1 (brain) (PGAM1) |
CNY 3080.00 |
|
PH304054 | PGAM1 MS Standard C13 and N15-labeled recombinant protein (NP_002620) |
CNY 19520.00 |