Ubiquilin (UBQLN1) (NM_053067) Human Recombinant Protein
CAT#: TP304020
Recombinant protein of human ubiquilin 1 (UBQLN1), transcript variant 2, 20 µg
View other "Ubiquilin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204020 protein sequence
Red=Cloning site Green=Tags(s) MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFK SHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSG SATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIM ANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQ EPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTA SGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMQNP DTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTT EPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQP S myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_444295 |
Locus ID | 29979 |
UniProt ID | Q9UMX0 |
Refseq Size | 4093 |
Cytogenetics | 9q21.2-q21.3 |
Refseq ORF | 1683 |
Synonyms | DA41; DSK2; PLIC-1; UBQN; XDRP1 |
Summary | This gene encodes an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402265 | UBQLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409314 | UBQLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402265 | Transient overexpression lysate of ubiquilin 1 (UBQLN1), transcript variant 1 |
CNY 3,080.00 |
|
LY409314 | Transient overexpression lysate of ubiquilin 1 (UBQLN1), transcript variant 2 |
CNY 3,080.00 |
|
PH304020 | UBQLN1 MS Standard C13 and N15-labeled recombinant protein (NP_444295) |
CNY 19,520.00 |
|
PH306897 | UBQLN1 MS Standard C13 and N15-labeled recombinant protein (NP_038466) |
CNY 19,520.00 |
|
TP306897 | Recombinant protein of human ubiquilin 1 (UBQLN1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Ubiquilin产品