Clusterin (CLU) (NM_203339) Human Recombinant Protein
CAT#: TP303941
Recombinant protein of human clusterin (CLU), transcript variant 2, 20 µg
View other "Clusterin" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203941 protein sequence
Red=Cloning site Green=Tags(s) MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL LSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL EEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS LPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDD DRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW KMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP VEVSRKNPKFMETVAEKALQEYRKKHREE SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 50 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_976084 |
Locus ID | 1191 |
UniProt ID | P10909 |
Refseq Size | 3012 |
Cytogenetics | 8p21.1 |
Refseq ORF | 1347 |
Synonyms | AAG4; APOJ; CLI; KUB1; MGC24903; SGP-2; SGP2; SP-40; TRPM-2; TRPM2 |
Summary | The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Protective role of clusterin in preserving endothelial function in AL amyloidosis
,null,
Atherosclerosis
,PubMed ID 22981431
[CLU]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404400 | CLU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433124 | CLU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404400 | Transient overexpression lysate of clusterin (CLU), transcript variant 2 |
CNY 3080.00 |
|
LY433124 | Transient overexpression lysate of clusterin (CLU), transcript variant 3 |
CNY 3080.00 |
|
PH303941 | CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084) |
CNY 14250.00 |
|
PH311875 | CLU MS Standard C13 and N15-labeled recombinant protein (NP_001822) |
CNY 19520.00 |
|
TP311875 | Recombinant protein of human clusterin (CLU), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720381 | Recombinant protein of human clusterin (CLU), transcript variant 1 |
CNY 1800.00 |
其它Clusterin产品