Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Recombinant Protein
CAT#: TP303828
Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, 20 µg
View other "Protein Kinase A regulatory subunit I alpha" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203828 protein sequence
Red=Cloning site Green=Tags(s) MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQK AGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSH LDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTP RAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQ KIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKL DRPRFERVLGPCSDILKRNIQQYNSFVSLSV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002725 |
Locus ID | 5573 |
UniProt ID | P10644, B2R5T5 |
Refseq Size | 4325 |
Cytogenetics | 17q24.2 |
Refseq ORF | 1143 |
Synonyms | ACRDYS1; ADOHR; CAR; CNC; CNC1; PKR1; PPNAD1; PRKAR1; TSE1 |
Summary | cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Several alternatively spliced transcript variants encoding two different isoforms have been observed. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Apoptosis, Insulin signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
STK25 inhibits PKA signaling by phosphorylating PRKAR1A
,null,
Cell reports
,PubMed ID 35977512
[PRKAR1A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400963 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403944 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403945 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431006 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400963 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1 |
CNY 3,080.00 |
|
LY403944 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 |
CNY 3,080.00 |
|
LY403945 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3 |
CNY 3,080.00 |
|
LY431006 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 |
CNY 3,080.00 |
|
PH303828 | PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_002725) |
CNY 19,520.00 |
|
PH310623 | PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997636) |
CNY 19,520.00 |
|
PH312810 | PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997637) |
CNY 19,520.00 |
|
TP310623 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP312810 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Protein Kinase A regulatory subunit I alpha产品