Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Mass Spec Standard
CAT#: PH312810
PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997637)
View other "Protein Kinase A regulatory subunit I alpha" proteins (13)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
CN¥ 1,999.00
CN¥ 2,700.00
CN¥ 3,080.00
Specifications
Product Data | |
Description | PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997637) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212810 |
Predicted MW | 43 kDa |
Protein Sequence |
>RC212810 protein sequence
Red=Cloning site Green=Tags(s) MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQK AGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSH LDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTP RAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQ KIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKL DRPRFERVLGPCSDILKRNIQQYNSFVSLSV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_997637 |
RefSeq Size | 4356 |
RefSeq ORF | 1143 |
Synonyms | ACRDYS1; ADOHR; CAR; CNC; CNC1; PKR1; PPNAD1; PRKAR1; TSE1 |
Locus ID | 5573 |
Cytogenetics | 17q24.2 |
Summary | cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Several alternatively spliced transcript variants encoding two different isoforms have been observed. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Apoptosis, Insulin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400963 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC403944 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC403945 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC431006 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400963 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1 |
CN¥ 3,080.00 |
|
LY403944 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 |
CN¥ 3,080.00 |
|
LY403945 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3 |
CN¥ 3,080.00 |
|
LY431006 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 |
CN¥ 3,080.00 |
|
PH303828 | PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_002725) |
CN¥ 19,520.00 |
|
PH310623 | PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997636) |
CN¥ 19,520.00 |
|
TP303828 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP310623 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP312810 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
其它Protein Kinase A regulatory subunit I alpha产品