United States
Germany
Japan
United Kingdom
China
CHI3L2 (NM_001025199) Human Recombinant Protein
CAT＃: TP303807
Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 3, 20 µg
View other "CHI3L2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203807 protein sequence
Red=Cloning site Green=Tags(s) MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNK VIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGL DVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLL SFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAET TVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLK NLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001020370 |
| Locus ID | 1117 |
| UniProt ID | Q15782 |
| Refseq Size | 1516 |
| Cytogenetics | 1p13.2 |
| Refseq ORF | 1173 |
| Synonyms | CHIL2; YKL-39; YKL39 |
| Summary | The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400404 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418266 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422601 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400404 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 3 |
CNY 3,080.00 |
|
| LY418266 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 1 |
CNY 3,080.00 |
|
| LY422601 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 2 |
CNY 3,080.00 |
|
| PH303807 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020370) |
CNY 19,520.00 |
|
| PH320804 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_003991) |
CNY 19,520.00 |
|
| PH320858 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020368) |
CNY 19,520.00 |
|
| TP320804 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP320858 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 2, 20 µg |
CNY 2,900.00 |
