United States
Germany
Japan
United Kingdom
China
CHI3L2 (NM_001025199) Human Mass Spec Standard
CAT＃: PH303807
CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020370)
View other "CHI3L2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020370) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203807 |
| Predicted MW | 43.5 kDa |
| Protein Sequence |
>RC203807 protein sequence
Red=Cloning site Green=Tags(s) MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNK VIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGL DVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLL SFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAET TVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLK NLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001020370 |
| RefSeq Size | 1516 |
| RefSeq ORF | 1173 |
| Synonyms | CHIL2; YKL-39; YKL39 |
| Locus ID | 1117 |
| Cytogenetics | 1p13.2 |
| Summary | The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400404 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418266 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422601 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400404 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 3 |
CNY 3,080.00 |
|
| LY418266 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 1 |
CNY 3,080.00 |
|
| LY422601 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 2 |
CNY 3,080.00 |
|
| PH320804 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_003991) |
CNY 19,520.00 |
|
| PH320858 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020368) |
CNY 19,520.00 |
|
| TP303807 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP320804 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP320858 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 2, 20 µg |
CNY 2,900.00 |
