FLAP (ALOX5AP) (NM_001629) Human Recombinant Protein
CAT#: TP303785
Recombinant protein of human arachidonate 5-lipoxygenase-activating protein (ALOX5AP), 20 µg
View other "FLAP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203785 protein sequence
Red=Cloning site Green=Tags(s) MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAV LWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG SDFENYIKTISTTISPLLLIP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001620 |
Locus ID | 241 |
UniProt ID | P20292 |
Refseq Size | 921 |
Cytogenetics | 13q12.3 |
Refseq ORF | 483 |
Synonyms | FLAP |
Summary | This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400611 | ALOX5AP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400611 | Transient overexpression lysate of arachidonate 5-lipoxygenase-activating protein (ALOX5AP) |
CN¥ 3,080.00 |
|
PH303785 | ALOX5AP MS Standard C13 and N15-labeled recombinant protein (NP_001620) |
CN¥ 19,520.00 |