FLAP (ALOX5AP) (NM_001629) Human Mass Spec Standard
CAT#: PH303785
ALOX5AP MS Standard C13 and N15-labeled recombinant protein (NP_001620)
View other "FLAP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ALOX5AP MS Standard C13 and N15-labeled recombinant protein (NP_001620) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203785 |
Predicted MW | 18.2 kDa |
Protein Sequence |
>RC203785 protein sequence
Red=Cloning site Green=Tags(s) MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAV LWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG SDFENYIKTISTTISPLLLIP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001620 |
RefSeq Size | 921 |
RefSeq ORF | 483 |
Synonyms | FLAP |
Locus ID | 241 |
Cytogenetics | 13q12.3 |
Summary | This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400611 | ALOX5AP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400611 | Transient overexpression lysate of arachidonate 5-lipoxygenase-activating protein (ALOX5AP) |
CNY 3,080.00 |
|
TP303785 | Recombinant protein of human arachidonate 5-lipoxygenase-activating protein (ALOX5AP), 20 µg |
CNY 2,900.00 |