MAT1A (NM_000429) Human Recombinant Protein
CAT#: TP303765
Recombinant protein of human methionine adenosyltransferase I, alpha (MAT1A), 20 µg
View other "MAT1A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203765 protein sequence
Red=Cloning site Green=Tags(s) MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE ITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMFG YATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIVISVQHN EDITLEEMRRALKEQVIRAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGG AFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH KNFDLRPGVIVRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKLVF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000420 |
Locus ID | 4143 |
UniProt ID | Q00266 |
Refseq Size | 3419 |
Cytogenetics | 10q22.3 |
Refseq ORF | 1185 |
Synonyms | MAT; MATA1; SAMS; SAMS1 |
Summary | This gene catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. The encoded protein is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in this gene are associated with methionine adenosyltransferase deficiency. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Human Liver Methionine Cycle: MAT1A and GNMT
,null,
Drug Metabolism and Disposition
,PubMed ID 22807109
[MAT1A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400152 | MAT1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400152 | Transient overexpression lysate of methionine adenosyltransferase I, alpha (MAT1A) |
CNY 3,080.00 |
|
PH303765 | MAT1A MS Standard C13 and N15-labeled recombinant protein (NP_000420) |
CNY 19,520.00 |