United States
Germany
Japan
United Kingdom
China
DTX2 (NM_020892) Human Recombinant Protein
CAT＃: TP303717
Recombinant protein of human deltex homolog 2 (Drosophila) (DTX2), transcript variant 1, 20 µg
View other "DTX2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203717 protein sequence
Red=Cloning site Green=Tags(s) MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADP SLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGN QLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPV SGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLY RSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPV CLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS AASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEV LRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRL IFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 67.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_065943 |
| Locus ID | 113878 |
| UniProt ID | Q86UW9 |
| Refseq Size | 2835 |
| Cytogenetics | 7q11.23 |
| Refseq ORF | 1866 |
| Synonyms | RNF58 |
| Summary | DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Notch signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412251 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420163 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420164 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420165 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY412251 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 1 |
CNY 3,080.00 |
|
| LY420163 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 2 |
CNY 4,840.00 |
|
| LY420164 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 3 |
CNY 4,840.00 |
|
| LY420165 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 4 |
CNY 4,840.00 |
|
| PH303717 | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_065943) |
CNY 19,520.00 |
|
| PH312997 | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096064) |
CNY 14,250.00 |
|
| PH313418 | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096065) |
CNY 14,250.00 |
|
| TP312997 | Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP313418 | Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 3, 20 µg |
CNY 2,900.00 |
