LSM10 (NM_032881) Human Recombinant Protein
CAT#: TP303562
Recombinant protein of human LSM10, U7 small nuclear RNA associated (LSM10), 20 µg
View other "LSM10" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203562 protein sequence
Red=Cloning site Green=Tags(s) MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLD DLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116270 |
Locus ID | 84967 |
UniProt ID | Q969L4 |
Refseq Size | 869 |
Cytogenetics | 1p34.3 |
Refseq ORF | 369 |
Synonyms | MST074; MSTP074 |
Summary | Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403211 | LSM10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403211 | Transient overexpression lysate of LSM10, U7 small nuclear RNA associated (LSM10) |
CNY 3,080.00 |
|
PH303562 | LSM10 MS Standard C13 and N15-labeled recombinant protein (NP_116270) |
CNY 19,520.00 |