LSM10 (NM_032881) Human Mass Spec Standard
CAT#: PH303562
LSM10 MS Standard C13 and N15-labeled recombinant protein (NP_116270)
View other "LSM10" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LSM10 MS Standard C13 and N15-labeled recombinant protein (NP_116270) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203562 |
Predicted MW | 14.1 kDa |
Protein Sequence |
>RC203562 protein sequence
Red=Cloning site Green=Tags(s) MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLD DLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116270 |
RefSeq Size | 869 |
RefSeq ORF | 369 |
Synonyms | MST074; MSTP074 |
Locus ID | 84967 |
Cytogenetics | 1p34.3 |
Summary | Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403211 | LSM10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403211 | Transient overexpression lysate of LSM10, U7 small nuclear RNA associated (LSM10) |
CNY 3,080.00 |
|
TP303562 | Recombinant protein of human LSM10, U7 small nuclear RNA associated (LSM10), 20 µg |
CNY 2,900.00 |