ZFYVE21 (NM_024071) Human Recombinant Protein
CAT#: TP303337
Recombinant protein of human zinc finger, FYVE domain containing 21 (ZFYVE21), 20 µg
View other "ZFYVE21" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
CNY 1,999.00
CNY 2,700.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203337 protein sequence
Red=Cloning site Green=Tags(s) MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG RRQAVAWLVAMHKAAKLLYESRDQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076976 |
Locus ID | 79038 |
UniProt ID | Q9BQ24 |
Refseq Size | 1470 |
Cytogenetics | 14q32.33 |
Refseq ORF | 702 |
Synonyms | HCVP7TP1; ZF21 |
Summary | Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression.[UniProtKB/Swiss-Prot Function] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
A ZFYVE21-Rubicon-RNF34 signaling complex promotes endosome-associated inflammasome activity in endothelial cells
,null,
Nature Communications
,PubMed ID 37225719
[ZFYVE21]
|
ZFYVE21 is a complement-induced Rab5 effector that activates non-canonical NF-κB via phosphoinosotide remodeling of endosomes
,Fang, C;Manes, TD;Liu, L;Liu, K;Qin, L;Li, G;Tobiasova, Z;Kirkiles-Smith, NC;Patel, M;Merola, J;Fu, W;Liu, R;Xie, C;Tietjen, GT;Nigrovic, PA;Tellides, G;Pober, JS;Jane-Wit, D;,
Nat Commun
,PubMed ID 31113953
[ZFYVE21]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411387 | ZFYVE21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411387 | Transient overexpression lysate of zinc finger, FYVE domain containing 21 (ZFYVE21) |
CNY 3,080.00 |
|
PH303337 | ZFYVE21 MS Standard C13 and N15-labeled recombinant protein (NP_076976) |
CNY 19,520.00 |
其它ZFYVE21产品