MAGP2 (MFAP5) (NM_003480) Human Recombinant Protein
CAT#: TP303242
Recombinant protein of human microfibrillar associated protein 5 (MFAP5), 20 µg
View other "MAGP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203242 protein sequence
Red=Cloning site Green=Tags(s) MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003471 |
Locus ID | 8076 |
UniProt ID | Q13361, B3KW70 |
Refseq Size | 2949 |
Cytogenetics | 12p13.31 |
Refseq ORF | 519 |
Synonyms | AAT9; MAGP-2; MAGP2; MFAP-5; MP25 |
Summary | This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401177 | MFAP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401177 | Transient overexpression lysate of microfibrillar associated protein 5 (MFAP5) |
CNY 3,080.00 |
|
PH303242 | MFAP5 MS Standard C13 and N15-labeled recombinant protein (NP_003471) |
CNY 19,520.00 |