MAGP2 (MFAP5) (NM_003480) Human Mass Spec Standard
CAT#: PH303242
MFAP5 MS Standard C13 and N15-labeled recombinant protein (NP_003471)
View other "MAGP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MFAP5 MS Standard C13 and N15-labeled recombinant protein (NP_003471) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203242 |
Predicted MW | 19.6 kDa |
Protein Sequence |
>RC203242 protein sequence
Red=Cloning site Green=Tags(s) MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003471 |
RefSeq Size | 2949 |
RefSeq ORF | 519 |
Synonyms | AAT9; MAGP-2; MAGP2; MFAP-5; MP25 |
Locus ID | 8076 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401177 | MFAP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401177 | Transient overexpression lysate of microfibrillar associated protein 5 (MFAP5) |
CNY 3,080.00 |
|
TP303242 | Recombinant protein of human microfibrillar associated protein 5 (MFAP5), 20 µg |
CNY 2,900.00 |