PSG5 (NM_002781) Human Recombinant Protein
CAT#: TP303134
Recombinant protein of human pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1, 20 µg
View other "PSG5" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203134 protein sequence
Red=Cloning site Green=Tags(s) MGPLSAPPCTQHITWKGVLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKG QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTF NLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKQPIENRILILPSVTRN ETGPYECEIRDRDGGMHSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQ QSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002772 |
Locus ID | 5673 |
UniProt ID | Q15238, A0A024R0S1 |
Refseq Size | 1669 |
Cytogenetics | 19q13.31 |
Refseq ORF | 1005 |
Synonyms | FL-NCA-3; PSG |
Summary | The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).[supplied by OMIM, Oct 2009] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419109 | PSG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427103 | PSG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419109 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1 |
CNY 3,080.00 |
|
LY427103 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 2 |
CNY 3,080.00 |
|
PH303134 | PSG5 MS Standard C13 and N15-labeled recombinant protein (NP_002772) |
CNY 19,520.00 |
|
TP721096 | Purified recombinant protein of Human pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1 |
CNY 3,140.00 |