PSG5 (NM_002781) Human Mass Spec Standard
CAT#: PH303134
PSG5 MS Standard C13 and N15-labeled recombinant protein (NP_002772)
View other "PSG5" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PSG5 MS Standard C13 and N15-labeled recombinant protein (NP_002772) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203134 |
Predicted MW | 37.7 kDa |
Protein Sequence |
>RC203134 protein sequence
Red=Cloning site Green=Tags(s) MGPLSAPPCTQHITWKGVLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKG QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTF NLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKQPIENRILILPSVTRN ETGPYECEIRDRDGGMHSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQ QSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002772 |
RefSeq Size | 1669 |
RefSeq ORF | 1005 |
Synonyms | FL-NCA-3; PSG |
Locus ID | 5673 |
Cytogenetics | 19q13.31 |
Summary | The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).[supplied by OMIM, Oct 2009] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419109 | PSG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427103 | PSG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419109 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1 |
CNY 3,080.00 |
|
LY427103 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 2 |
CNY 3,080.00 |
|
TP303134 | Recombinant protein of human pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP721096 | Purified recombinant protein of Human pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1 |
CNY 3,140.00 |