CCDC53 (WASHC3) (NM_016053) Human Recombinant Protein
CAT#: TP303045
Recombinant protein of human coiled-coil domain containing 53 (CCDC53), 20 µg
View other "CCDC53" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203045 protein sequence
Red=Cloning site Green=Tags(s) MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILD AKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQSSTQDSGLQESEVSAENILTVAKDPRYARYL KMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057137 |
Locus ID | 51019 |
UniProt ID | Q9Y3C0 |
Refseq Size | 1015 |
Cytogenetics | 12q23.2 |
Refseq ORF | 582 |
Synonyms | CCDC53; CGI-116 |
Summary | Acts at least in part as component of the WASH core complex whose assembly at the surface of endosomes seems to inhibit WASH nucleation-promoting factor (NPF) activity in recruiting and activating the Arp2/3 complex to induce actin polymerization, and which is involved in regulation of the fission of tubules that serve as transport intermediates during endosome sorting (PubMed:19922875, PubMed:20498093).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414219 | CCDC53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414219 | Transient overexpression lysate of coiled-coil domain containing 53 (CCDC53) |
CNY 3,080.00 |
|
PH303045 | CCDC53 MS Standard C13 and N15-labeled recombinant protein (NP_057137) |
CNY 19,520.00 |