AP2S1 (NM_004069) Human Recombinant Protein
CAT#: TP302919
Recombinant protein of human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17, 20 µg
View other "AP2S1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202919 protein sequence
Red=Cloning site Green=Tags(s) MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCIC VDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQS LE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004060 |
Locus ID | 1175 |
UniProt ID | P53680 |
Refseq Size | 965 |
Cytogenetics | 19q13.32 |
Refseq ORF | 426 |
Synonyms | AP17; CLAPS2; FBH3; FBHOk; HHC3 |
Summary | One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Pathways | Endocytosis, Huntington's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418235 | AP2S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418235 | Transient overexpression lysate of adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17 |
CNY 3,080.00 |
|
PH302919 | AP2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004060) |
CNY 19,520.00 |