AP2S1 (NM_004069) Human Mass Spec Standard
CAT#: PH302919
AP2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004060)
View other "AP2S1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | AP2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004060) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202919 |
Predicted MW | 17 kDa |
Protein Sequence |
>RC202919 protein sequence
Red=Cloning site Green=Tags(s) MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCIC VDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQS LE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004060 |
RefSeq Size | 965 |
RefSeq ORF | 426 |
Synonyms | AP17; CLAPS2; FBH3; FBHOk; HHC3 |
Locus ID | 1175 |
Cytogenetics | 19q13.32 |
Summary | One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Pathways | Endocytosis, Huntington's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418235 | AP2S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418235 | Transient overexpression lysate of adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17 |
CNY 3,080.00 |
|
TP302919 | Recombinant protein of human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17, 20 µg |
CNY 2,900.00 |