Alpha B Crystallin (CRYAB) (NM_001885) Human Recombinant Protein
CAT#: TP302718
Recombinant protein of human crystallin, alpha B (CRYAB), 20 µg
View other "Alpha B Crystallin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202718 protein sequence
Red=Cloning site Green=Tags(s) MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRL EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSD GVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001876 |
Locus ID | 1410 |
UniProt ID | P02511 |
Refseq Size | 998 |
Cytogenetics | 11q23.1 |
Refseq ORF | 525 |
Synonyms | CMD1II; CRYA2; CTPP2; CTRCT16; HEL-S-101; HSPB5; MFM2 |
Summary | Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2019] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419682 | CRYAB HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419682 | Transient overexpression lysate of crystallin, alpha B (CRYAB) |
CN¥ 3,080.00 |
|
PH302718 | CRYAB MS Standard C13 and N15-labeled recombinant protein (NP_001876) |
CN¥ 19,520.00 |
|
TP720099 | Recombinant protein of human crystallin, alpha B (CRYAB) |
CN¥ 1,800.00 |
其它Alpha B Crystallin产品