G3BP (G3BP1) (NM_005754) Human Recombinant Protein
CAT#: TP302692
Recombinant protein of human GTPase activating protein (SH3 domain) binding protein 1 (G3BP1), transcript variant 1, 20 µg
View other "G3BP" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202692 protein sequence
Red=Cloning site Green=Tags(s) MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNF TNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGG FVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEI QEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPAS QPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHE VDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAARE GDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005745 |
Locus ID | 10146 |
UniProt ID | Q13283 |
Refseq Size | 2855 |
Cytogenetics | 5q33.1 |
Refseq ORF | 1398 |
Synonyms | G3BP; HDH-VIII |
Summary | This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405046 | G3BP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417094 | G3BP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405046 | Transient overexpression lysate of GTPase activating protein (SH3 domain) binding protein 1 (G3BP1), transcript variant 2 |
CNY 3080.00 |
|
LY417094 | Transient overexpression lysate of GTPase activating protein (SH3 domain) binding protein 1 (G3BP1), transcript variant 1 |
CNY 3080.00 |
|
PH302692 | G3BP1 MS Standard C13 and N15-labeled recombinant protein (NP_005745) |
CNY 19520.00 |
|
PH310616 | G3BP1 MS Standard C13 and N15-labeled recombinant protein (NP_938405) |
CNY 19520.00 |
|
TP310616 | Recombinant protein of human GTPase activating protein (SH3 domain) binding protein 1 (G3BP1), transcript variant 2, 20 µg |
CNY 2900.00 |