MAD2L1 binding protein (MAD2L1BP) (NM_014628) Human Recombinant Protein
CAT#: TP302640
Recombinant protein of human MAD2L1 binding protein (MAD2L1BP), transcript variant 2, 20 µg
View other "MAD2L1 binding protein" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202640 protein sequence
Red=Cloning site Green=Tags(s) MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLED FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055443 |
Locus ID | 9587 |
UniProt ID | Q15013 |
Refseq Size | 1283 |
Cytogenetics | 6p21.1 |
Refseq ORF | 822 |
Synonyms | CMT2 |
Summary | The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400374 | MAD2L1BP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC402356 | MAD2L1BP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400374 | Transient overexpression lysate of MAD2L1 binding protein (MAD2L1BP), transcript variant 1 |
CNY 3,080.00 |
|
LY402356 | Transient overexpression lysate of MAD2L1 binding protein (MAD2L1BP), transcript variant 2 |
CNY 3,080.00 |
|
PH302640 | MAD2L1BP MS Standard C13 and N15-labeled recombinant protein (NP_055443) |
CNY 19,520.00 |
|
TP760973 | Purified recombinant protein of Human MAD2L1 binding protein (MAD2L1BP), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它MAD2L1 binding protein产品