MAD2L1 binding protein (MAD2L1BP) (NM_014628) Human Mass Spec Standard
CAT#: PH302640
MAD2L1BP MS Standard C13 and N15-labeled recombinant protein (NP_055443)
View other "MAD2L1 binding protein" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | MAD2L1BP MS Standard C13 and N15-labeled recombinant protein (NP_055443) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202640 |
Predicted MW | 31.1 kDa |
Protein Sequence |
>RC202640 protein sequence
Red=Cloning site Green=Tags(s) MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLED FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055443 |
RefSeq Size | 1283 |
RefSeq ORF | 822 |
Synonyms | CMT2 |
Locus ID | 9587 |
Cytogenetics | 6p21.1 |
Summary | The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Molecular inflammation and adipose tissue matrix remodeling precede physiological adaptations to pregnancy
,null,
American Journal of Physiology - Endocrinology and Metabolism
,PubMed ID 22811467
[MAD2L1BP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400374 | MAD2L1BP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC402356 | MAD2L1BP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400374 | Transient overexpression lysate of MAD2L1 binding protein (MAD2L1BP), transcript variant 1 |
CNY 3,080.00 |
|
LY402356 | Transient overexpression lysate of MAD2L1 binding protein (MAD2L1BP), transcript variant 2 |
CNY 3,080.00 |
|
TP302640 | Recombinant protein of human MAD2L1 binding protein (MAD2L1BP), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760973 | Purified recombinant protein of Human MAD2L1 binding protein (MAD2L1BP), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它MAD2L1 binding protein产品