CHST12 (NM_018641) Human Recombinant Protein
CAT#: TP302514
Recombinant protein of human carbohydrate (chondroitin 4) sulfotransferase 12 (CHST12), 20 µg
View other "CHST12" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202514 protein sequence
Red=Cloning site Green=Tags(s) MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDRELTADSDVDEFL DKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFP TKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNA SAHLTFNKFWRRYGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYAN HTSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAA QLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061111 |
Locus ID | 55501 |
UniProt ID | Q9NRB3 |
Refseq Size | 2159 |
Cytogenetics | 7p22.3 |
Refseq ORF | 1242 |
Synonyms | C4S-2; C4ST-2; C4ST2 |
Summary | The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin and desulfated dermatan sulfate. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage, and is distributed on the surfaces of many cells and extracellular matrices. Alternatively spliced transcript variants differing only in their 5' UTRs have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Transmembrane |
Protein Pathways | Chondroitin sulfate biosynthesis, Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412989 | CHST12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412989 | Transient overexpression lysate of carbohydrate (chondroitin 4) sulfotransferase 12 (CHST12) |
CNY 3,080.00 |
|
PH302514 | CHST12 MS Standard C13 and N15-labeled recombinant protein (NP_061111) |
CNY 19,520.00 |