Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Recombinant Protein
CAT#: TP302475
Recombinant protein of human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 20 µg
View other "Phosphoserine Aminotransferase" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202475 representing NM_058179
Red=Cloning site Green=Tags(s) MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY KVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTW NLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVV IVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYE IIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT IEDVQKLAAFMKKFLEMHQL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 40.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_478059 |
Locus ID | 29968 |
UniProt ID | Q9Y617 |
Refseq Size | 2221 |
Cytogenetics | 9q21.2 |
Refseq ORF | 1110 |
Synonyms | EPIP; NLS2; PSA; PSAT; PSATD |
Summary | This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. [provided by RefSeq, Jul 2013] |
Protein Pathways | Glycine, serine and threonine metabolism, Metabolic pathways, Vitamin B6 metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Knock-down of PSAT1 Enhances Sensitivity of NSCLC Cells to Glutamine-limiting Conditions.
,null,
Anticancer research
,PubMed ID 31810937
[PSAT1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409248 | PSAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409248 | Transient overexpression lysate of phosphoserine aminotransferase 1 (PSAT1), transcript variant 1 |
CNY 3,080.00 |
|
PH302475 | PSAT1 MS Standard C13 and N15-labeled recombinant protein (NP_478059) |
CNY 19,520.00 |
其它Phosphoserine Aminotransferase产品