KEAP1 (NM_203500) Human Recombinant Protein
CAT#: TP302189
Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1, 20 µg
View other "KEAP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 6 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202189 protein sequence
Red=Cloning site Green=Tags(s) MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL RLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFA YTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMH FGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNF LQMQLQKCEILQSDSRCKDYLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDG TWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECY YPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGIT VHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.5 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_987096 |
Locus ID | 9817 |
UniProt ID | Q14145 |
Refseq Size | 2606 |
Cytogenetics | 19p13.2 |
Refseq ORF | 1872 |
Synonyms | INrf2; KLHL19 |
Summary | This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Ubiquitin mediated proteolysis |
Citations (6)
The use of this Proteins has been cited in the following citations: |
---|
Seaweed natural products modify the host inflammatory response via Nrf2 signaling and alter colon microbiota composition and gene expression
,Bousquet, MS;Ratnayake, R;Pope, JL;Chen, QY;Zhu, F;Chen, S;Carney, TJ;Gharaibeh, RZ;Jobin, C;Paul, VJ;Luesch, H;,
Free Radic. Biol. Med.
,PubMed ID 31536771
[KEAP1]
|
Characterization of RA839, a Noncovalent Small Molecule Binder to Keap1 and Selective Activator of Nrf2 Signaling *
,null,
The Journal of Biological Chemistry
,PubMed ID 26459563
[KEAP1]
|
Ginger Compound [6]-Shogaol and Its Cysteine-Conjugated Metabolite (M2) Activate Nrf2 in Colon Epithelial Cells in Vitro and in Vivo
,Chen, H;Fu, J;Chen, H;Hu, Y;Soroka, DN;Prigge, JR;Schmidt, EE;Yan, F;Major, MB;Chen, X;Sang, S;,
Chem. Res. Toxicol.
,PubMed ID 25148906
[KEAP1]
|
Small molecules inhibit the interaction of Nrf2 and the Keap1 Kelch domain through a non-covalent mechanism
,null,
Bioorganic Medicinal Chemistry
,PubMed ID 23647822
[KEAP1]
|
Identification of UV-protective Activators of Nuclear Factor Erythroid-derived 2-Related Factor 2 (Nrf2) by Combining a Chemical Library Screen with Computer-based Virtual Screening *
,null,
The Journal of Biological Chemistry
,PubMed ID 22851183
[KEAP1]
|
Identification of UV-protective Activators of Nuclear Factor Erythroid-derived 2-Related Factor 2 (Nrf2) by Combining a Chemical Library Screen with Computer-based Virtual Screening
,Franziska Lieder, Felix Reisen, Tim Geppert, Gabriel Sollberger, Hans-Dietmar Beer, Ulrich auf dem Keller, Matthias Schäfer, Michael Detmar, Gisbert Schneider, and Sabine Werner,
J. Biol. Chem., Sep 2012; 287: 33001 - 33013.
[KEAP1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402183 | KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404250 | KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402183 | Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2 |
CNY 3,080.00 |
|
LY404250 | Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1 |
CNY 3,080.00 |
|
PH302189 | KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_987096) |
CNY 19,520.00 |
|
PH302513 | KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036421) |
CNY 19,520.00 |
|
TP302513 | Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2, 20 µg |
CNY 2,900.00 |