GCIP interacting protein p29 (SYF2) (NM_015484) Human Recombinant Protein
CAT#: TP302167
Recombinant protein of human SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1, 20 µg
View other "GCIP interacting protein p29" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202167 protein sequence
Red=Cloning site Green=Tags(s) MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEA KKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTK QIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDY INERNAKFNKKAERFYGKYTAEIKQNLERGTAV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056299 |
Locus ID | 25949 |
UniProt ID | O95926 |
Refseq Size | 1777 |
Cytogenetics | 1p36.11 |
Refseq ORF | 729 |
Synonyms | CBPIN; fSAP29; NTC31; P29 |
Summary | This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404061 | SYF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414518 | SYF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404061 | Transient overexpression lysate of SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 2 |
CNY 3,080.00 |
|
LY414518 | Transient overexpression lysate of SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1 |
CNY 3,080.00 |
|
PH302167 | SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299) |
CNY 19,520.00 |
其它GCIP interacting protein p29产品