GCIP interacting protein p29 (SYF2) (NM_015484) Human Mass Spec Standard
CAT#: PH302167
SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299)
View other "GCIP interacting protein p29" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202167 |
Predicted MW | 28.7 kDa |
Protein Sequence |
>RC202167 protein sequence
Red=Cloning site Green=Tags(s) MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEA KKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTK QIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDY INERNAKFNKKAERFYGKYTAEIKQNLERGTAV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056299 |
RefSeq Size | 1777 |
RefSeq ORF | 729 |
Synonyms | CBPIN; fSAP29; NTC31; P29 |
Locus ID | 25949 |
Cytogenetics | 1p36.11 |
Summary | This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404061 | SYF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC414518 | SYF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY404061 | Transient overexpression lysate of SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 2 |
CN¥ 3,080.00 |
|
LY414518 | Transient overexpression lysate of SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1 |
CN¥ 3,080.00 |
|
TP302167 | Recombinant protein of human SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
其它GCIP interacting protein p29产品