SERPINB1 (NM_030666) Human Recombinant Protein
CAT#: TP302138
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1), 20 µg
View other "SERPINB1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 2 publications. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202138 protein sequence
Red=Cloning site Green=Tags(s) MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRF QSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQT EGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIE DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEE SYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE NFTADHPFLFFIRHNSSGSILFLGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Peptidase assay (inhibitor) (PMID: 26701651) ELISA standard (PMID: 28292880) |
Reference Data | |
RefSeq | NP_109591 |
Locus ID | 1992 |
UniProt ID | P30740 |
Refseq Size | 2678 |
Cytogenetics | 6p25.2 |
Refseq ORF | 1137 |
Synonyms | EI; ELANH2; HEL-S-27; HEL57; LEI; M/NEI; MNEI; PI-2; PI2 |
Summary | The protein encoded by this gene is a member of the serpin family of proteinase inhibitors. Members of this family maintain homeostasis by neutralizing overexpressed proteinase activity through their function as suicide substrates. This protein inhibits the neutrophil-derived proteinases neutrophil elastase, cathepsin G, and proteinase-3 and thus protects tissues from damage at inflammatory sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Protein Families | Druggable Genome |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Plasma serpinB1 is related to insulin sensitivity but not pancreatic β-Cell function in non-diabetic adults
,Glicksman, M;Asthana, A;Abel, BS;Walter, MF;Skarulis, MC;Muniyappa, R;,
Physiol Rep
,PubMed ID 28292880
[SERPINB1]
|
SerpinB1 Promotes Pancreatic ß Cell Proliferation
,El Ouaamari, A;Dirice, E;Gedeon, N;Hu, J;Zhou, JY;Shirakawa, J;Hou, L;Goodman, J;Karampelias, C;Qiang, G;Boucher, J;Martinez, R;Gritsenko, MA;De Jesus, DF;Kahraman, S;Bhatt, S;Smith, RD;Beer, HD;Jungtrakoon, P;Gong, Y;Goldfine, AB;Liew, CW;Doria, A;Andersson, O;Qian, WJ;Remold-O'Donnell, E;Kulkarni, RN;,
Cell Metab.
,PubMed ID 26701651
[SERPINB1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410744 | SERPINB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY410744 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1) |
CN¥ 3,080.00 |
|
PH302138 | SERPINB1 MS Standard C13 and N15-labeled recombinant protein (NP_109591) |
CN¥ 19,520.00 |
|
TP760029 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |
其它SERPINB1产品