RBBP9 (NM_006606) Human Recombinant Protein
CAT#: TP302090
Recombinant protein of human retinoblastoma binding protein 9 (RBBP9), 20 µg
View other "RBBP9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 1,999.00
CN¥ 2,700.00
CN¥ 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202090 protein sequence
Red=Cloning site Green=Tags(s) MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTI IIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006597 |
Locus ID | 10741 |
UniProt ID | O75884 |
Refseq Size | 3871 |
Cytogenetics | 20p11.23 |
Refseq ORF | 558 |
Synonyms | BOG; RBBP10 |
Summary | The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401976 | RBBP9 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401976 | Transient overexpression lysate of retinoblastoma binding protein 9 (RBBP9) |
CN¥ 3,080.00 |
|
PH302090 | RBBP9 MS Standard C13 and N15-labeled recombinant protein (NP_006597) |
CN¥ 19,520.00 |