RBBP9 (NM_006606) Human Mass Spec Standard
CAT#: PH302090
RBBP9 MS Standard C13 and N15-labeled recombinant protein (NP_006597)
View other "RBBP9" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RBBP9 MS Standard C13 and N15-labeled recombinant protein (NP_006597) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202090 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC202090 protein sequence
Red=Cloning site Green=Tags(s) MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTI IIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006597 |
RefSeq Size | 3871 |
RefSeq ORF | 558 |
Synonyms | BOG; RBBP10 |
Locus ID | 10741 |
Cytogenetics | 20p11.23 |
Summary | The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401976 | RBBP9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401976 | Transient overexpression lysate of retinoblastoma binding protein 9 (RBBP9) |
CNY 3,080.00 |
|
TP302090 | Recombinant protein of human retinoblastoma binding protein 9 (RBBP9), 20 µg |
CNY 2,900.00 |