UCHL3 (NM_006002) Human Recombinant Protein
CAT#: TP302065
Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), 20 µg
View other "UCHL3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202065 protein sequence
Red=Cloning site Green=Tags(s) MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLEN YDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCK KFMERDPDELRFNAIALSAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005993 |
Locus ID | 7347 |
UniProt ID | P15374 |
Refseq Size | 972 |
Cytogenetics | 13q22.2 |
Refseq ORF | 690 |
Synonyms | UCH-L3 |
Summary | The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401817 | UCHL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401817 | Transient overexpression lysate of ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3) |
CNY 3,080.00 |
|
PH302065 | UCHL3 MS Standard C13 and N15-labeled recombinant protein (NP_005993) |
CNY 19,520.00 |
|
TP720166 | Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3) |
CNY 1,800.00 |