UCHL3 (NM_006002) Human Mass Spec Standard
CAT#: PH302065
UCHL3 MS Standard C13 and N15-labeled recombinant protein (NP_005993)
View other "UCHL3" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UCHL3 MS Standard C13 and N15-labeled recombinant protein (NP_005993) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202065 |
Predicted MW | 26.2 kDa |
Protein Sequence |
>RC202065 protein sequence
Red=Cloning site Green=Tags(s) MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLEN YDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCK KFMERDPDELRFNAIALSAA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005993 |
RefSeq Size | 972 |
RefSeq ORF | 690 |
Synonyms | UCH-L3 |
Locus ID | 7347 |
Cytogenetics | 13q22.2 |
Summary | The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401817 | UCHL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401817 | Transient overexpression lysate of ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3) |
CNY 3,080.00 |
|
TP302065 | Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), 20 µg |
CNY 2,900.00 |
|
TP720166 | Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3) |
CNY 3,140.00 |